PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 450aa    MW: 49528 Da    PI: 7.8687
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026458genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.41.1e-39170247178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C+ dls+akeyhr+h+vCe hsk+++v+v gle+rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  DCAR_026458 170 RCQVENCNLDLSSAKEYHRKHRVCESHSKCSKVVVGGLERRFCQQCSRFHSLLEFDEKKRSCRKRLSDHNARRRKPQH 247
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-31165232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.274168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-37169250IPR004333Transcription factor, SBP-box
PfamPF031109.3E-30171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MEWNAKWDWE NLDTFCSKYN GVPNKLETTE WGVQEGDIDV GSFHLSGAIG DSASDVCHAS  60
SAKSSVSAST DCSSKGRVKT SKLSFGPLGE YSADFSKKQE SERAELVRTS PSLDTSVGSA  120
ELSIGLKLGK RTYFENCSTG NNSSSSNIPV ASASTAKKLR PPCQNAPAPR CQVENCNLDL  180
SSAKEYHRKH RVCESHSKCS KVVVGGLERR FCQQCSRFHS LLEFDEKKRS CRKRLSDHNA  240
RRRKPQHETI HFKTTSMSSV FEGRQQMSFA PMSQSRPAED SNWEYKNTYK CALATEHLLK  300
PEISSVVNMQ SHLPWSRLPH AISMPTQDSG RLLQFKGSSE GCRQGIPESV FSSNLDAATD  360
LHCALSLLST NSLGSCDQGS ANHNYSVNAT YKNISPQMMH AIPQNLPSAS SECWQSEDTH  420
ILASNITCGS NYQENQFFSA PYGNGFYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-271712441184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226243KKRSCRKRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271312.21e-134PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_010655960.11e-134PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
RefseqXP_010655962.11e-134PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
RefseqXP_010655967.11e-134PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
TrEMBLF6HGB11e-134F6HGB1_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g03710.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-59squamosa promoter binding protein-like 2